CM18-PTD4 | SCGE Toolkit

SCGE Consortium Home | About SCGE Toolkit | Contact Us | Citing the Toolkit | License

Home / Delivery Systems

Summary Projects & Experiments

SCGE ID	12000000162
Name	CM18-PTD4
Description	Shuttle peptide
Type	Amphiphilic peptide

Source	Feldan Therapeutics (synthetic peptide from GL Biochem, 95% purity)

Sequence	HHHHHHKWKLFKKIGAVLKVLTTGYARAAARQARAHHHHHH

Publication Title
Engineered amphiphilic peptides enable delivery of proteins and CRISPR-associated nucleases to airway epithelia. NCBI

This Delivery System: CM18-PTD4 is being used ...

Project	Initiative	Contact PI
Delivery of CRISPR Ribonucleoproteins to Airway Epithelia Using Novel Amphiphilic Peptides Experiments Gene editing in vitro by various peptide variants delivering Cas RNPs to primary Human airway epithelia cells. Gene editing in vitro by various peptide variants delivering Cas12a in NK cells.	Delivery Systems	Paul B McCray, Jr, MD (University of Iowa)