Delivery System: S10
Summary
SCGE ID | 12000000041 |
Name | S10 |
Description | Shuttle peptide used to deliver reagents to airway epithelia |
Type | Amphiphilic peptide |
Source | McCray Lab |
Sequence | KWKLARAFARAIKKLGGSGGGSYARALRRQARTG |
Associated Publications |
Publication Title |
---|
Engineered amphiphilic peptides enable delivery of proteins and CRISPR-associated nucleases to airway epithelia. NCBI |
Related Publications |
Publication Title |
---|
Engineered amphiphilic peptides enable delivery of proteins and CRISPR-associated nucleases to airway epithelia. NCBI |