S10 | SCGE Toolkit

SCGE Consortium Home | About SCGE Toolkit | Contact Us | Citing the Toolkit | License

Home / Delivery Systems

Summary Projects & Experiments

SCGE ID	12000000041
Name	S10
Description	Shuttle peptide used to deliver reagents to airway epithelia
Type	Amphiphilic peptide

Source	McCray Lab

Sequence	KWKLARAFARAIKKLGGSGGGSYARALRRQARTG

Publication Title
Engineered amphiphilic peptides enable delivery of proteins and CRISPR-associated nucleases to airway epithelia. NCBI

Publication Title
Engineered amphiphilic peptides enable delivery of proteins and CRISPR-associated nucleases to airway epithelia. NCBI

This Delivery System: S10 is being used ...

Project	Initiative	Contact PI
Delivery of CRISPR Ribonucleoproteins to Airway Epithelia Using Novel Amphiphilic Peptides Experiments Shuttle peptides enable in vivo gene editing with Cas9 and Cas12a RNP in mouse airway epithelia Gene editing in vitro by various peptide variants delivering Cas12a in NK cells. Testing Shuttle Peptides ability to deliver GFP-NLS to airway epithelia. Peptide Shuttle optimization to deliver Cas9 RNP to human airway epithelia cells Peptide Shuttle optimization to deliver Cas12a RNP to human airway epithelia cells Gene editing in vitro by various peptide variants delivering Cas RNPs to primary Human airway epithelia cells.	Delivery Systems	Paul B McCray, Jr, MD (University of Iowa)
Enhancing CRISPR Gene Editing in Somatic Tissues by Chemical Modification of Guides and Donors Experiments Delivery of unmodified, phosphorothioate (PS)-stabilized crRNA with chemically modified, PS-stabilized tracrRNA using the S10 shuttle peptide to activate the mTmG reporter in mouse brain	Delivery Systems	Erik J Sontheimer, PhD (University of Massachusetts Medical School, Worcester)
Base Editing in Rhesus Airway Epithelial Experiments Delivery of ABE8e-Cas9 RNP using Shuttle peptide candidates to rhesus monkey airway epithelial cells cultured at the air liquid interface targeting CCR5 locus. Amphiphilic Peptides Deliver Base Editor RNPs to Rhesus Monkey Airway Delivery of Cas9 RNP using Shuttle peptide candidates to human airway epithelial cells cultured at the air liquid interface targeting CFTR locus Delivery of ABE8e-Cas9 RNP using Shuttle peptide candidates to human airway epithelial cells cultured at the air liquid interface targeting B2M locus Inhibitory effect of Cas9 RNP alone on S10- or FSDS315-mediated GFP protein delivery to HeLa cells	Collaborative Opportunity Fund	Paul B McCray, Jr, MD Alice F Tarantal, PhD David Guay, PhD David R Liu, PhD (University of Iowa)